Select a topic you want to learn

• How to upload and submit your sequences

  You can input your sequences using one of the following methods:

  1. Amino acid sequence (FASTA format)

  2. PDB ID, Uniprot ID, RefSeq ID, Human Ensemble transcript ID

  3. Upload SMLF (simple mutation list format) file, you can find information here: SMLF - Structman docs

  

  After you enter your sequences, click submit button

  

• How to check your results

  After you uploaded your sequences, you will be given your job id and results page link

  You will be automatically redirected to your results page

  Or you can save your Job ID to check your results later

  

  You can check & download your result in results page

  To view and download your results, please follow these steps:

  1. Enter your job ID in the provided input field.

  2. Click the "Submit" button.

  3. Wait for the results to load. This may take a few moments depending on the size of your data.

  

• Interpret your results

  Results are served in 3 different containers.

  

  1. Classification

  a. Classification table

  b. PDB viewer

  c. Clickable recommended structure column

  d. Clickable max seq id structure column

  

  2. Protein protein interaction

  a. Protein protein interaction table

  b. Network viewer

  

  3. Position position interaction

  a. Position position interaction table

  b. PDB viewer

  c. Clickable structure recommendation column

  

  To download tables, you can use the select table to download button.

  You can select individual or all the tables to download

  

• Examples

  FASTA

  For FASTA input, you can use "Fill Example" button in the submission page to populate the input fields with example data.

  FASTA example

  Copy Show Results

  >Merlin
  MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
  FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
  QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
  PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
  LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
  IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
  LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
  EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
  YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
  ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL
                      

  ID

  For ID input, you can use the "Fill Example" button on the submission page to populate the input fields with example data. Please note that the IDs must correspond to proteins from the selected organism database.

  ID example

  Copy Show Results

  P01584
  P14778
  P27930
                      

  SMLF

  For SMLF input, you can download an example SMLF file using the button below, or use the "Fill Example" button on the submission page to populate the file upload field with example data. This option is used for uploading SMLF files.

  SMLF (Simple Mutation List Format) example

  Show Results

  P01584
  P14778
  P27930
                      

  For example output, you can use "Fill Example" button in the results page to populate the input fields with example data. Or you can check example output.